seo site checkup logo
PricingFree ToolsArticles
Report generated a day ago
https://dev.sawaribooking.com
Your general SEO Checkup Score
Archived
61/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 61 out of 100, which is below the average score of 75. However, there are 19 SEO issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
19 Failed
2 Warnings
39 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
LOW
A proper character encoding declaration ensures that all characters, including non-ASCII characters, are displayed correctly in the browser, improving the readability and usability of the webpage.
LOW
Consider reducing the HTML size to improve loading times and retain visitors.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 51
Failed: 8
Warnings: 1
Passed: 13
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Sawaribooking | Rent Cars,Jeep and More
Length: 39 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 99 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Rent vehicles at affordable prices. Choose from our wide selection of cars,jeep and other vehicles.
Length: 99 characters
Google Search Results Preview Test
Desktop version
https://dev.sawaribooking.com/Sawaribooking | Rent Cars,Jeep and MoreRent vehicles at affordable prices. Choose from our wide selection of cars,jeep and other vehicles.
Mobile version
https://dev.sawaribooking.com/Sawaribooking | Rent Cars,Jeep and MoreRent vehicles at affordable prices. Choose from our wide selection of cars,jeep and other vehicles.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Sawaribooking | Rent Cars,Jeep and More
og:description
Rent vehicles at affordable prices. Choose from our wide selection of cars,jeep and other vehicles.
og:site_name
Vehicle Rental
og:locale
en_US
og:type
website
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
40sedan36vehicle36suvs35nbsp30roads
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
sedan
vehicle
suvs
nbsp
roads
Keywords Cloud Test
adventureairportaprilbestbetterbookingbudgetbuiltbustlingchallengingchoicechoosechoosingcityclearancecomecomfortconditionscostcostsdealingdecidedecisionsdestinationdifferencediversedrivedrivingeaseeasierefficiencyenjoyableexploringextrafacefuelgeargroundgroupguidehandlehaveheadinghelphigherhimalayasidealincludesjourneykathmandulandscapeluggagemakemakingmountainnavigatingnbspneedneedsnepalofferoffersplanplanningprovideprovidesrangereadreadyrenderrentrentalrequirementsreservationrightroadsroughrsquoruralsafetysavesedansedansselectserviceservicessimplesmoothspacestreetssuddensuvsterraintrailstraveltravelingunevenvehicleweatherwheel
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Services We Provide
Get Started with 4 Easy Steps
Sawari Booking is a premier vehicle rental platform offering over 200 options
Sed
Doloremque adipisci
Cum officia earum au
Ratione Nam ullam la
Nesciunt consequunt
Frequently Asked Questions
Frequently Asked Questions - Vehicle Rental
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a meta charset tag but is not fully contained in the first 1024 bytes of the HTML document! The element containing the character encoding declaration must be serialized completely within the first 1024 bytes of the document, otherwise it can significantly affect load performance.
Speed optimizations
Score: 62
Failed: 6
Warnings: 1
Passed: 13
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,494 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using zstd compression on your code. The HTML code is compressed from 489.62 Kb to 128.82 Kb (74% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.28 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
58.7 %
2.30 Mb
javascript
35.2 %
1.38 Mb
css
2.0 %
80.75 Kb
font
2.0 %
80.11 Kb
other
1.5 %
60.56 Kb
html
0.6 %
25.92 Kb
TOTAL
100%
3.92 Mb
Requests by content type
Content type
Percent
Requests
javascript
62.2 %
97
other
21.8 %
34
image
8.3 %
13
css
4.5 %
7
html
1.9 %
3
font
1.3 %
2
TOTAL
100%
156
Content size by domain
Domain
Percent
Size
dev.sawaribooking.com
78.1 %
3.06 Mb
demo.sawaribooking.com
13.7 %
548.83 Kb
maps.googleapis.com
7.9 %
315.78 Kb
static.cloudflareinsights.com
0.2 %
6.94 Kb
maps.gstatic.com
0.1 %
5.43 Kb
flagcdn.com
0.1 %
2.09 Kb
TOTAL
100%
3.92 Mb
Requests by domain
Domain
Percent
Requests
dev.sawaribooking.com
87.8 %
137
demo.sawaribooking.com
4.5 %
7
maps.googleapis.com
3.8 %
6
flagcdn.com
1.9 %
3
maps.gstatic.com
1.3 %
2
static.cloudflareinsights.com
0.6 %
1
TOTAL
100%
156
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.549 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.549 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 3.400 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

3.4 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 5.64 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

5.64 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Rent a vehicle with lowest price
Html: <div class="w-full flex flex-col justify-center items-center" style="min-height: 700px; background-image: url("/_next/s...">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.1147. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.1147

0.1

0.25

DOM element which contributes the most to CLS score:
Text: One way Two way Select Pick Up Date Click to select date Choose Pick Location De...
Html: <div class="w-full max-w-full">
Score: 0.0910
Server and security
Score: 68
Failed: 3
Warnings: 0
Passed: 4
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "dev.sawaribooking.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
sawaribooking.com
Subject Alternative Names (SANs)
sawaribooking.com, *.sawaribooking.com
Not valid before
Tue, December 9o 2025, 5:09:49 am (z)
Not valid after
Mon, March 9o 2026, 6:08:38 am (z)
Signature algorithm
ecdsaWithSha256
Issuer
WE1
Root certificate
Common name
WE1
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test97% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 80
Failed: 2
Warnings: 0
Passed: 6
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved